PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017584
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family STAT
Protein Properties Length: 731aa    MW: 81420.4 Da    PI: 5.6618
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017584genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1941.6e-602303511122
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldv+ll+a+gqpv+kdvevvasLlyad+ ++vek+ daeapLL+sydG+ef+s drp+kl++GrasfklkisqLsskcdn+Lf++ feip+l kypf+
  DCAR_017584 230 LDVILLDAIGQPVNKDVEVVASLLYADNEAPVEKPIDAEAPLLTSYDGIEFASWDRPSKLINGRASFKLKISQLSSKCDNKLFCLGFEIPDLGKYPFF 327
                  8************************************************************************************************* PP

         STAT  99 eavskpirCisrsrntrsssltkk 122
                  +a+s+pirCisr r  r+s +t+k
  DCAR_017584 328 RAISHPIRCISRHRYPRASPSTWK 351
                  ***************999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498992.69E-710146IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2001.2E-619150IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555501.14E-8618685IPR000980SH2 domain
Gene3DG3DSA:3.30.505.102.4E-6620682IPR000980SH2 domain
PROSITE profilePS500019.885621730IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MGSSETMKEN DYLMLKDLKL EIQENNDSAT RGFAVCFWLY LQTCTSFPSI LLHHQVNTDG  60
TCSVPFLGLN EKKKLMLFPL SFLHQEAPSP GDQSWIENTC ASSKTEFPLK KWVHVGCEVS  120
VDFVRLYTNG ALVGVKPLSS ALNRDSHLNG PGLVSLSSTH GEAAGSYEIQ GYVHGVEILS  180
PTSPLKNYYL KDPPLQLSID ESSASDIDEE FDGVWGIVGG KASCRRNFSL DVILLDAIGQ  240
PVNKDVEVVA SLLYADNEAP VEKPIDAEAP LLTSYDGIEF ASWDRPSKLI NGRASFKLKI  300
SQLSSKCDNK LFCLGFEIPD LGKYPFFRAI SHPIRCISRH RYPRASPSTW KHQTSSMHLL  360
NSSQSFGMGE ESSDIPQNTV SAEKQSPSSK RIKLAQEKPL ALGRVGILLE QVNREGNPPA  420
LICNKDNVTS LQKLQETYVE AEKCSSGSES SEAGISKSCS ISSSEAPFSD SAIFRYCLEG  480
LSERSLMLKE IAKVASEQEL VNFAEQVSLY SGCFHHRHQI GMSKGLIENG NKAWNSVSEK  540
NKQVLWDNLS SEIEEEFKKI SCCSTRYLSV EDLELLRKIA GCQEVVKREN FERLWSWLYP  600
VAFTLSQEWV KVVWDSVLPK WIEGFITKEE AEASLQGPNG LQDPGTFVLR FPTSRSWPHP  660
DAGNLVVTYV GSDYNIHHKL LSLDLINSSG AKERNVKPLK EMLLEEPELS RLGRQETLTI  720
NLKSLFFKFD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644056.10.0PREDICTED: uncharacterized protein LOC100260583 isoform X2
TrEMBLA0A068UD020.0A0A068UD02_COFCA; Uncharacterized protein
STRINGVIT_19s0014g00140.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B